| Class a: All alpha proteins [46456] (171 folds) |
| Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (2 proteins) |
| Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species) topologically similar to the second domain |
| Species Rat (Rattus norvegicus) [TaxId:10116] [47806] (10 PDB entries) |
| Domain d1huoa1: 1huo A:10-91 [61273] Other proteins in same PDB: d1huoa3, d1huoa4, d1huob3, d1huob4 |
PDB Entry: 1huo (more details), 2.6 Å
SCOP Domain Sequences for d1huoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1huoa1 a.60.6.1 (A:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Rat (Rattus norvegicus)}
tlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
aekideflatgklrklekirqd
Timeline for d1huoa1: