Lineage for d1huoa1 (1huo A:10-91)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 214550Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 214655Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 214656Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (2 proteins)
  6. 214657Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
    topologically similar to the second domain
  7. 214751Species Rat (Rattus norvegicus) [TaxId:10116] [47806] (10 PDB entries)
  8. 214752Domain d1huoa1: 1huo A:10-91 [61273]
    Other proteins in same PDB: d1huoa3, d1huoa4, d1huob3, d1huob4

Details for d1huoa1

PDB Entry: 1huo (more details), 2.6 Å

PDB Description: crystal structure of dna polymerase beta complexed with dna and cr-tmppcp

SCOP Domain Sequences for d1huoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1huoa1 a.60.6.1 (A:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Rat (Rattus norvegicus)}
tlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
aekideflatgklrklekirqd

SCOP Domain Coordinates for d1huoa1:

Click to download the PDB-style file with coordinates for d1huoa1.
(The format of our PDB-style files is described here.)

Timeline for d1huoa1: