Lineage for d1huoa1 (1huo A:10-91)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48649Fold a.60: SAM domain-like [47768] (10 superfamilies)
  4. 48731Superfamily a.60.6: DNA polymerase beta, N-terminal (8 kD)-domain [47802] (1 family) (S)
  5. 48732Family a.60.6.1: DNA polymerase beta, N-terminal (8 kD)-domain [47803] (1 protein)
  6. 48733Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
  7. 48825Species Rat (Rattus norvegicus) [TaxId:10116] [47806] (10 PDB entries)
  8. 48826Domain d1huoa1: 1huo A:10-91 [61273]
    Other proteins in same PDB: d1huoa2, d1huob2

Details for d1huoa1

PDB Entry: 1huo (more details), 2.6 Å

PDB Description: crystal structure of dna polymerase beta complexed with dna and cr-tmppcp

SCOP Domain Sequences for d1huoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1huoa1 a.60.6.1 (A:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Rat (Rattus norvegicus)}
tlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
aekideflatgklrklekirqd

SCOP Domain Coordinates for d1huoa1:

Click to download the PDB-style file with coordinates for d1huoa1.
(The format of our PDB-style files is described here.)

Timeline for d1huoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1huoa2