Class b: All beta proteins [48724] (165 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (7 families) |
Family b.2.5.2: p53 DNA-binding domain-like [81314] (2 proteins) |
Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [63683] (1 PDB entry) |
Domain d1hu8b_: 1hu8 B: [61270] |
PDB Entry: 1hu8 (more details), 2.7 Å
SCOP Domain Sequences for d1hu8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hu8b_ b.2.5.2 (B:) p53 tumor suppressor, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} tyqgnygfhlgflqsgtaksvmctyspplnklfcqlaktcpvqlwvsatppagsrvrama iykksqhmtevvrrcphhercsdgdglappqhlirvegnlapeyledrqtfrhsvvvpye ppeagseyttihykymcnsscmggmnrrpiltiitledssgnllgrdsfevrvcacpgrd rrteee
Timeline for d1hu8b_: