Lineage for d1htzb_ (1htz B:)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 883341Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 883342Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families) (S)
  5. 883343Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (18 proteins)
  6. 883462Protein beta-Lactamase, class A [56606] (15 species)
  7. 883539Species Klebsiella pneumoniae, TEM52 [TaxId:573] [64473] (1 PDB entry)
  8. 883541Domain d1htzb_: 1htz B: [61263]

Details for d1htzb_

PDB Entry: 1htz (more details), 2.4 Å

PDB Description: crystal structure of tem52 beta-lactamase
PDB Compounds: (B:) beta-lactamase mutant tem52

SCOP Domain Sequences for d1htzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htzb_ e.3.1.1 (B:) beta-Lactamase, class A {Klebsiella pneumoniae, TEM52 [TaxId: 573]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlvkyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgasergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

SCOP Domain Coordinates for d1htzb_:

Click to download the PDB-style file with coordinates for d1htzb_.
(The format of our PDB-style files is described here.)

Timeline for d1htzb_: