SCOP 1.75: Domain d1htza_: 1htz A:

Lineage for d1htza_ (1htz A:)

1. Root: SCOP 1.75

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (18 proteins)

6. Protein beta-Lactamase, class A [56606] (15 species)

7. Species Klebsiella pneumoniae, TEM52 [TaxId:573] [64473] (1 PDB entry)

8. Domain d1htza_: 1htz A: [61262]

Details for d1htza_

PDB Entry: 1htz, 2.4 Å

PDB Description: crystal structure of tem52 beta-lactamase

PDB Compounds: (A:) beta-lactamase mutant tem52

SCOP Domain Sequences for d1htza_:

Sequence; same for both SEQRES and ATOM records:

>d1htza_ e.3.1.1 (A:) beta-Lactamase, class A {Klebsiella pneumoniae, TEM52 [TaxId: 573]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlvkyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgasergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

Timeline for d1htza_:

• d1htza_ first appeared in SCOP 1.57
  
• d1htza_ appears in SCOP 1.73
  
• d1htza_ appears in SCOPe 2.01
  
• d1htza_ appears in the current release, SCOPe 2.08