![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
![]() | Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) ![]() |
![]() | Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins) |
![]() | Protein Pdz-RhoGEF RGS-like domain [63586] (1 species) contains extra helices in the C-terminal extension |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63587] (1 PDB entry) |
![]() | Domain d1htjf_: 1htj F: [61254] |
PDB Entry: 1htj (more details), 2.2 Å
SCOPe Domain Sequences for d1htjf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1htjf_ a.91.1.1 (F:) Pdz-RhoGEF RGS-like domain {Human (Homo sapiens) [TaxId: 9606]} esdiifqdleklksrpahlgvflryifsqadpspllfylcaevyqqaspkdsrslgkdiw nifleknaplrvkipemlqaeidsrlrnsedargvlceaqeaampeiqeqihdyrtkrtl glgslygendlldldgdplrerqvaekqlaalgdilsayaadrsapmdfalntymshagi rl
Timeline for d1htjf_: