Lineage for d1htjf_ (1htj F:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 99579Fold a.91: Regulator of G-protein signalling, RGS [48096] (1 superfamily)
  4. 99580Superfamily a.91.1: Regulator of G-protein signalling, RGS [48097] (1 family) (S)
  5. 99581Family a.91.1.1: Regulator of G-protein signalling, RGS [48098] (6 proteins)
  6. 99592Protein Pdz-RhoGEF RGS-like domain [63586] (1 species)
  7. 99593Species Human (Homo sapiens) [TaxId:9606] [63587] (1 PDB entry)
  8. 99594Domain d1htjf_: 1htj F: [61254]

Details for d1htjf_

PDB Entry: 1htj (more details), 2.2 Å

PDB Description: structure of the rgs-like domain from pdz-rhogef

SCOP Domain Sequences for d1htjf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htjf_ a.91.1.1 (F:) Pdz-RhoGEF RGS-like domain {Human (Homo sapiens)}
esdiifqdleklksrpahlgvflryifsqadpspllfylcaevyqqaspkdsrslgkdiw
nifleknaplrvkipemlqaeidsrlrnsedargvlceaqeaampeiqeqihdyrtkrtl
glgslygendlldldgdplrerqvaekqlaalgdilsayaadrsapmdfalntymshagi
rl

SCOP Domain Coordinates for d1htjf_:

Click to download the PDB-style file with coordinates for d1htjf_.
(The format of our PDB-style files is described here.)

Timeline for d1htjf_: