Lineage for d1htjf_ (1htj F:)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.91: Regulator of G-protein signalling, RGS [48096] (1 superfamily) Superfamily a.91.1: Regulator of G-protein signalling, RGS [48097] (1 family) 
Family a.91.1.1: Regulator of G-protein signalling, RGS [48098] (6 proteins) 
Protein Pdz-RhoGEF RGS-like domain [63586] (1 species) Species Human (Homo sapiens) [TaxId:9606] [63587] (1 PDB entry) 
Domain d1htjf_: 1htj F: [61254]
Details for d1htjf_
PDB Entry: 1htj (more details), 2.2 Å
PDB Description: structure of the rgs-like domain from pdz-rhogef
SCOP Domain Sequences for d1htjf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1htjf_ a.91.1.1 (F:) Pdz-RhoGEF RGS-like domain {Human (Homo sapiens)}
esdiifqdleklksrpahlgvflryifsqadpspllfylcaevyqqaspkdsrslgkdiw
nifleknaplrvkipemlqaeidsrlrnsedargvlceaqeaampeiqeqihdyrtkrtl
glgslygendlldldgdplrerqvaekqlaalgdilsayaadrsapmdfalntymshagi
rl
SCOP Domain Coordinates for d1htjf_:
Click to download the PDB-style file with coordinates for d1htjf_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1htjf_:
- d1htjf_ is new in SCOP 1.57
- d1htjf_ appears in SCOP 1.59
- d1htjf_ appears in the current release, SCOPe 2.08
View in 3D