Lineage for d1ht9b_ (1ht9 B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47513Family a.39.1.1: Calbindin D9K [47474] (1 protein)
  6. 47514Protein Calbindin D9K [47475] (2 species)
  7. 47515Species Cow (Bos taurus) [TaxId:9913] [47476] (13 PDB entries)
  8. 47519Domain d1ht9b_: 1ht9 B: [61253]

Details for d1ht9b_

PDB Entry: 1ht9 (more details), 1.76 Å

PDB Description: domain swapping ef-hands
PDB Compounds: (B:)

SCOP Domain Sequences for d1ht9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ht9b_ a.39.1.1 (B:) Calbindin D9K {Cow (Bos taurus)}
mkspeelkgifekyaakegdpnnlskeelklllqtefpsllkgmstldelfeeldkngdg
evsfeefqvlvkkisq

SCOP Domain Coordinates for d1ht9b_:

Click to download the PDB-style file with coordinates for d1ht9b_.
(The format of our PDB-style files is described here.)

Timeline for d1ht9b_: