Lineage for d1ht3a_ (1ht3 A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70439Fold c.41: Subtilisin-like [52742] (1 superfamily)
  4. 70440Superfamily c.41.1: Subtilisin-like [52743] (2 families) (S)
  5. 70441Family c.41.1.1: Subtilases [52744] (7 proteins)
  6. 70448Protein Proteinase K [52762] (1 species)
  7. 70449Species Fungus (Tritirachium album), strain limber [TaxId:37998] [52763] (10 PDB entries)
  8. 70454Domain d1ht3a_: 1ht3 A: [61243]

Details for d1ht3a_

PDB Entry: 1ht3 (more details), 1.8 Å

PDB Description: mercury induced modifications in the stereochemistry of the active site through cys-73 in a serine protease: crystal structure of the complex of a partially modified proteinase k with mercury at 1.8 a resolution

SCOP Domain Sequences for d1ht3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ht3a_ c.41.1.1 (A:) Proteinase K {Fungus (Tritirachium album), strain limber}
aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
yssrdgnghgthcagtvgsrtygvvkktqlfgvkvlddngsgqystiiagmdfvasdknn
rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
gasdrydrrssfsnygsvldifgpgtsilstwiggstrsisgtsmatphvaglaaylmtl
gkttaasacryiadtankgdlsnipfgtvnllaynnyqa

SCOP Domain Coordinates for d1ht3a_:

Click to download the PDB-style file with coordinates for d1ht3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ht3a_: