Lineage for d1hsja2 (1hsj A:1-372)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 403440Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 403441Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 403442Family c.94.1.1: Phosphate binding protein-like [53851] (26 proteins)
  6. 403463Protein D-maltodextrin-binding protein, MBP [53862] (4 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 403474Species Escherichia coli [TaxId:562] [53863] (35 PDB entries)
  8. 403502Domain d1hsja2: 1hsj A:1-372 [61238]
    Other proteins in same PDB: d1hsja1, d1hsjb1

Details for d1hsja2

PDB Entry: 1hsj (more details), 2.3 Å

PDB Description: sarr mbp fusion structure

SCOP Domain Sequences for d1hsja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hsja2 c.94.1.1 (A:1-372) D-maltodextrin-binding protein, MBP {Escherichia coli}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
laaaqtnaaaef

SCOP Domain Coordinates for d1hsja2:

Click to download the PDB-style file with coordinates for d1hsja2.
(The format of our PDB-style files is described here.)

Timeline for d1hsja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hsja1