SCOPe 2.05: Domain d1hsja1: 1hsj A:373-487

Lineage for d1hsja1 (1hsj A:373-487)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein Staphylococcal accessory regulator A homolog, SarR [63472] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [63473] (1 PDB entry)

8. Domain d1hsja1: 1hsj A:373-487 [61237]
   Other proteins in same PDB: d1hsja2, d1hsjb2
   Fusion protein with E. coli MBP
   protein/DNA complex; complexed with glc

Details for d1hsja1

PDB Entry: 1hsj, 2.3 Å

PDB Description: sarr mbp fusion structure

PDB Compounds: (A:) fusion protein consisting of staphylococcus accessary regulator protein r and maltose binding protein

SCOPe Domain Sequences for d1hsja1:

Sequence; same for both SEQRES and ATOM records:

>d1hsja1 a.4.5.28 (A:373-487) Staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus [TaxId: 1280]}
mskindindlvnatfqvkkffrdtkkkfnlnyeeiyilnhilrsesneisskeiakcsef
kpyyltkalqklkdlkllskkrslqdertvivyvtdtqkaniqkliseleeyikn

Timeline for d1hsja1:

• d1hsja1 first appeared in SCOP 1.57
  
• d1hsja1 appears in SCOPe 2.04
  
• d1hsja1 appears in SCOPe 2.06
  
• d1hsja1 appears in the current release, SCOPe 2.08