Lineage for d1hs7a_ (1hs7 A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48354Fold a.47: STAT-like [47654] (2 superfamilies)
  4. 48363Superfamily a.47.2: t-snare proteins [47661] (1 family) (S)
  5. 48364Family a.47.2.1: t-snare proteins [47662] (3 proteins)
  6. 48375Protein Vam3p N-terminal domain [63559] (1 species)
  7. 48376Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63560] (1 PDB entry)
  8. 48377Domain d1hs7a_: 1hs7 A: [61236]

Details for d1hs7a_

PDB Entry: 1hs7 (more details)

PDB Description: vam3p n-terminal domain solution structure

SCOP Domain Sequences for d1hs7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hs7a_ a.47.2.1 (A:) Vam3p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
tnqktkelsnlietfaeqsrvlekectkigskrdskelrykietelipnctsvrdkiesn
ilihqngklsadfknlktkyqslqqsynqrkslfplk

SCOP Domain Coordinates for d1hs7a_:

Click to download the PDB-style file with coordinates for d1hs7a_.
(The format of our PDB-style files is described here.)

Timeline for d1hs7a_: