SCOPe 2.05: Domain d1hs6a2: 1hs6 A:1-208

Lineage for d1hs6a2 (1hs6 A:1-208)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
   duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain

4. Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families)

5. Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 proteins)

6. Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63740] (45 PDB entries)
   Uniprot P09960

8. Domain d1hs6a2: 1hs6 A:1-208 [61234]
   Other proteins in same PDB: d1hs6a1, d1hs6a3
   complexed with act, bes, imd, yb, zn

Details for d1hs6a2

PDB Entry: 1hs6, 1.95 Å

PDB Description: structure of leukotriene a4 hydrolase complexed with bestatin.

PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d1hs6a2:

Sequence; same for both SEQRES and ATOM records:

>d1hs6a2 b.98.1.1 (A:1-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
peivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdlt
iekvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltp
eqtsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpd
pedpsrkiykfiqkvpipcylialvvga

Timeline for d1hs6a2:

• d1hs6a2 first appeared in SCOP 1.57
  
• d1hs6a2 appears in SCOPe 2.04
  
• d1hs6a2 appears in SCOPe 2.06
  
• d1hs6a2 appears in the current release, SCOPe 2.08