Lineage for d1hs6a2 (1hs6 A:1-208)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 235430Fold b.98: Leukotriene A4 hydrolase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 235431Superfamily b.98.1: Leukotriene A4 hydrolase N-terminal domain [63737] (1 family) (S)
  5. 235432Family b.98.1.1: Leukotriene A4 hydrolase N-terminal domain [63738] (1 protein)
  6. 235433Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species)
  7. 235434Species Human (Homo sapiens) [TaxId:9606] [63740] (2 PDB entries)
  8. 235435Domain d1hs6a2: 1hs6 A:1-208 [61234]
    Other proteins in same PDB: d1hs6a1, d1hs6a3
    complexed with act, bes, imd, yb, zn

Details for d1hs6a2

PDB Entry: 1hs6 (more details), 1.95 Å

PDB Description: structure of leukotriene a4 hydrolase complexed with bestatin.

SCOP Domain Sequences for d1hs6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hs6a2 b.98.1.1 (A:1-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens)}
peivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdlt
iekvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltp
eqtsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpd
pedpsrkiykfiqkvpipcylialvvga

SCOP Domain Coordinates for d1hs6a2:

Click to download the PDB-style file with coordinates for d1hs6a2.
(The format of our PDB-style files is described here.)

Timeline for d1hs6a2: