Lineage for d1hs6a1 (1hs6 A:461-610)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216993Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 216994Superfamily a.118.1: ARM repeat [48371] (12 families) (S)
  5. 217112Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein)
    this is a repeat family; one repeat unit is 1gw6 A:513-547 found in domain
  6. 217113Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species)
  7. 217114Species Human (Homo sapiens) [TaxId:9606] [63610] (2 PDB entries)
  8. 217115Domain d1hs6a1: 1hs6 A:461-610 [61233]
    Other proteins in same PDB: d1hs6a2, d1hs6a3
    complexed with act, bes, imd, yb, zn

Details for d1hs6a1

PDB Entry: 1hs6 (more details), 1.95 Å

PDB Description: structure of leukotriene a4 hydrolase complexed with bestatin.

SCOP Domain Sequences for d1hs6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hs6a1 a.118.1.7 (A:461-610) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens)}
dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm
qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks
hdqavrtyqehkasmhpvtamlvgkdlkvd

SCOP Domain Coordinates for d1hs6a1:

Click to download the PDB-style file with coordinates for d1hs6a1.
(The format of our PDB-style files is described here.)

Timeline for d1hs6a1: