Lineage for d1hrkb_ (1hrk B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1878032Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 1878033Superfamily c.92.1: Chelatase [53800] (4 families) (S)
    interdomain linker is short; swapping of C-terminal helices between the two domains
  5. 1878034Family c.92.1.1: Ferrochelatase [53801] (2 proteins)
    automatically mapped to Pfam PF00762
  6. 1878035Protein Ferrochelatase [53802] (3 species)
  7. 1878057Species Human (Homo sapiens) [TaxId:9606] [64189] (21 PDB entries)
  8. 1878069Domain d1hrkb_: 1hrk B: [61229]
    complexed with chd, fes

Details for d1hrkb_

PDB Entry: 1hrk (more details), 2 Å

PDB Description: crystal structure of human ferrochelatase
PDB Compounds: (B:) Ferrochelatase

SCOPe Domain Sequences for d1hrkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hrkb_ c.92.1.1 (B:) Ferrochelatase {Human (Homo sapiens) [TaxId: 9606]}
rkpktgilmlnmggpetlgdvhdfllrlfldrdlmtlpiqnklapfiakrltpkiqeqyr
rigggspikiwtskqgegmvklldelspntaphkyyigfryvhplteeaieemerdgler
aiaftqypqyscsttgsslnaiyryynqvgrkptmkwstidrwpthhlliqcfadhilke
ldhfplekrsevvilfsahslpmsvvnrgdpypqevsatvqkvmerleycnpyrlvwqsk
vgpmpwlgpqtdesikglcergrknillvpiaftsdhietlyeldieysqvlakecgven
irraeslngnplfskaladlvhshiqsnelcskqltlscplcvnpvcretksfftsqql

SCOPe Domain Coordinates for d1hrkb_:

Click to download the PDB-style file with coordinates for d1hrkb_.
(The format of our PDB-style files is described here.)

Timeline for d1hrkb_: