Lineage for d1hrka_ (1hrk A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 845814Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 845815Superfamily c.92.1: Chelatase [53800] (3 families) (S)
    interdomain linker is short; swapping of C-terminal helices between the two domains
  5. 845816Family c.92.1.1: Ferrochelatase [53801] (1 protein)
  6. 845817Protein Ferrochelatase [53802] (3 species)
  7. 845832Species Human (Homo sapiens) [TaxId:9606] [64189] (2 PDB entries)
  8. 845835Domain d1hrka_: 1hrk A: [61228]

Details for d1hrka_

PDB Entry: 1hrk (more details), 2 Å

PDB Description: crystal structure of human ferrochelatase
PDB Compounds: (A:) Ferrochelatase

SCOP Domain Sequences for d1hrka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hrka_ c.92.1.1 (A:) Ferrochelatase {Human (Homo sapiens) [TaxId: 9606]}
rkpktgilmlnmggpetlgdvhdfllrlfldrdlmtlpiqnklapfiakrltpkiqeqyr
rigggspikiwtskqgegmvklldelspntaphkyyigfryvhplteeaieemerdgler
aiaftqypqyscsttgsslnaiyryynqvgrkptmkwstidrwpthhlliqcfadhilke
ldhfplekrsevvilfsahslpmsvvnrgdpypqevsatvqkvmerleycnpyrlvwqsk
vgpmpwlgpqtdesikglcergrknillvpiaftsdhietlyeldieysqvlakecgven
irraeslngnplfskaladlvhshiqsnelcskqltlscplcvnpvcretksfftsqql

SCOP Domain Coordinates for d1hrka_:

Click to download the PDB-style file with coordinates for d1hrka_.
(The format of our PDB-style files is described here.)

Timeline for d1hrka_: