Lineage for d1hr9e1 (1hr9 E:14-233)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 86102Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
  4. 86103Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
  5. 86104Family d.185.1.1: MPP-like [63412] (4 proteins)
  6. 86145Protein Mitochondrial processing peptidase (MPP) alpha chain [64302] (1 species)
  7. 86146Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64303] (4 PDB entries)
  8. 86175Domain d1hr9e1: 1hr9 E:14-233 [61220]
    Other proteins in same PDB: d1hr9b1, d1hr9b2, d1hr9d1, d1hr9d2, d1hr9f1, d1hr9f2, d1hr9h1, d1hr9h2

Details for d1hr9e1

PDB Entry: 1hr9 (more details), 3.01 Å

PDB Description: Yeast Mitochondrial Processing Peptidase beta-E73Q Mutant Complexed with Malate Dehydrogenase Signal Peptide

SCOP Domain Sequences for d1hr9e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr9e1 d.185.1.1 (E:14-233) Mitochondrial processing peptidase (MPP) alpha chain {Baker's yeast (Saccharomyces cerevisiae)}
artdnfklsslanglkvatsntpghfsalglyidagsrfegrnlkgcthildrlafkste
hvegramaetlellggnyqctssrenlmyqasvfnqdvgkmlqlmsetvrfpkiteqelq
eqklsaeyeidevwmkpelvlpellhtaaysgetlgsplicprglipsiskyylldyrnk
fytpentvaafvgvphekaleltgkylgdwqsthppitkk

SCOP Domain Coordinates for d1hr9e1:

Click to download the PDB-style file with coordinates for d1hr9e1.
(The format of our PDB-style files is described here.)

Timeline for d1hr9e1: