Lineage for d1hr9a2 (1hr9 A:234-470)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 739189Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 739190Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 739191Family d.185.1.1: MPP-like [63412] (6 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 739324Protein Mitochondrial processing peptidase (MPP) alpha chain [64302] (1 species)
  7. 739325Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64303] (4 PDB entries)
  8. 739343Domain d1hr9a2: 1hr9 A:234-470 [61213]
    Other proteins in same PDB: d1hr9b1, d1hr9b2, d1hr9d1, d1hr9d2, d1hr9f1, d1hr9f2, d1hr9h1, d1hr9h2

Details for d1hr9a2

PDB Entry: 1hr9 (more details), 3.01 Å

PDB Description: yeast mitochondrial processing peptidase beta-e73q mutant complexed with malate dehydrogenase signal peptide
PDB Compounds: (A:) mitochondrial processing peptidase alpha subunit

SCOP Domain Sequences for d1hr9a2:

Sequence, based on SEQRES records: (download)

>d1hr9a2 d.185.1.1 (A:234-470) Mitochondrial processing peptidase (MPP) alpha chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vaqytggescippapvfgnlpelfhiqigfeglpidhpdiyalatlqtllggggsfsagg
pgkgmysrlythvlnqyyfvencvafnhsysdsgifgislscipqaapqaveviaqqmyn
tfankdlrltedevsraknqlkssllmnlesklveledmgrqvlmhgrkipvnemiskie
dlkpddisrvaemiftgnvnnagngkgratvvmqgdrgsfgdvenvlkayglgnsss

Sequence, based on observed residues (ATOM records): (download)

>d1hr9a2 d.185.1.1 (A:234-470) Mitochondrial processing peptidase (MPP) alpha chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vaqytggescippapvfgnlpelfhiqigfeglpidhpdiyalatlqtllgggggpgkgm
ysrlythvlnqyyfvencvafnhsysdsgifgislscipqaapqaveviaqqmyntfank
dlrltedevsraknqlkssllmnlesklveledmgrqvlmhgrkipvnemiskiedlkpd
disrvaemiftgnvnnagngkgratvvmqgdrgsfgdvenvlkayglgnsss

SCOP Domain Coordinates for d1hr9a2:

Click to download the PDB-style file with coordinates for d1hr9a2.
(The format of our PDB-style files is described here.)

Timeline for d1hr9a2: