Lineage for d1hr8h1 (1hr8 H:22-245)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2237726Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 2237727Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 2237728Family d.185.1.1: MPP-like [63412] (7 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 2237911Protein Mitochondrial processing peptidase (MPP) beta chain [64300] (1 species)
  7. 2237912Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64301] (4 PDB entries)
  8. 2237935Domain d1hr8h1: 1hr8 H:22-245 [61210]
    Other proteins in same PDB: d1hr8a1, d1hr8a2, d1hr8c1, d1hr8c2, d1hr8d3, d1hr8e1, d1hr8e2, d1hr8f3, d1hr8g1, d1hr8g2
    complexed with epe, zn; mutant

Details for d1hr8h1

PDB Entry: 1hr8 (more details), 2.7 Å

PDB Description: Yeast Mitochondrial Processing Peptidase beta-E73Q Mutant Complexed with Cytochrome C Oxidase IV Signal Peptide
PDB Compounds: (H:) mitochondrial processing peptidase beta subunit

SCOPe Domain Sequences for d1hr8h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr8h1 d.185.1.1 (H:22-245) Mitochondrial processing peptidase (MPP) beta chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qipgtrtsklpngltiateyipntssatvgifvdagsraenvknngtahflqhlafkgtq
nrpqqgieleienigshlnaytsrentvyyakslqedipkavdilsdiltksvldnsaie
rerdviireseevdkmydevvfdhlheitykdqplgrtilgpikniksitrtdlkdyitk
nykgdrmvlagagavdheklvqyaqkyfghvpksespvplgspr

SCOPe Domain Coordinates for d1hr8h1:

Click to download the PDB-style file with coordinates for d1hr8h1.
(The format of our PDB-style files is described here.)

Timeline for d1hr8h1: