Lineage for d1hr8c2 (1hr8 C:234-468)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2237726Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 2237727Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 2237728Family d.185.1.1: MPP-like [63412] (7 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 2237877Protein Mitochondrial processing peptidase (MPP) alpha chain [64302] (1 species)
  7. 2237878Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64303] (4 PDB entries)
  8. 2237898Domain d1hr8c2: 1hr8 C:234-468 [61201]
    Other proteins in same PDB: d1hr8b1, d1hr8b2, d1hr8d1, d1hr8d2, d1hr8d3, d1hr8f1, d1hr8f2, d1hr8f3, d1hr8h1, d1hr8h2
    complexed with epe, zn; mutant

Details for d1hr8c2

PDB Entry: 1hr8 (more details), 2.7 Å

PDB Description: Yeast Mitochondrial Processing Peptidase beta-E73Q Mutant Complexed with Cytochrome C Oxidase IV Signal Peptide
PDB Compounds: (C:) mitochondrial processing peptidase alpha subunit

SCOPe Domain Sequences for d1hr8c2:

Sequence, based on SEQRES records: (download)

>d1hr8c2 d.185.1.1 (C:234-468) Mitochondrial processing peptidase (MPP) alpha chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vaqytggescippapvfgnlpelfhiqigfeglpidhpdiyalatlqtllggggsfsagg
pgkgmysrlythvlnqyyfvencvafnhsysdsgifgislscipqaapqaveviaqqmyn
tfankdlrltedevsraknqlkssllmnlesklveledmgrqvlmhgrkipvnemiskie
dlkpddisrvaemiftgnvnnagngkgratvvmqgdrgsfgdvenvlkayglgns

Sequence, based on observed residues (ATOM records): (download)

>d1hr8c2 d.185.1.1 (C:234-468) Mitochondrial processing peptidase (MPP) alpha chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vaqytggescippapvfgnlpelfhiqigfeglpidhpdiyalatlqtllgggggpgkgm
ysrlythvlnqyyfvencvafnhsysdsgifgislscipqaapqaveviaqqmyntfank
dlrltedevsraknqlkssllmnlesklveledmgrqvlmhgrkipvnemiskiedlkpd
disrvaemiftgnvnnagngkgratvvmqgdrgsfgdvenvlkayglgns

SCOPe Domain Coordinates for d1hr8c2:

Click to download the PDB-style file with coordinates for d1hr8c2.
(The format of our PDB-style files is described here.)

Timeline for d1hr8c2: