Lineage for d1hr8a2 (1hr8 A:234-470)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1943314Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 1943315Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 1943316Family d.185.1.1: MPP-like [63412] (7 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 1943461Protein Mitochondrial processing peptidase (MPP) alpha chain [64302] (1 species)
  7. 1943462Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64303] (4 PDB entries)
  8. 1943480Domain d1hr8a2: 1hr8 A:234-470 [61197]
    Other proteins in same PDB: d1hr8b1, d1hr8b2, d1hr8d1, d1hr8d2, d1hr8f1, d1hr8f2, d1hr8h1, d1hr8h2
    complexed with epe, zn; mutant

Details for d1hr8a2

PDB Entry: 1hr8 (more details), 2.7 Å

PDB Description: Yeast Mitochondrial Processing Peptidase beta-E73Q Mutant Complexed with Cytochrome C Oxidase IV Signal Peptide
PDB Compounds: (A:) mitochondrial processing peptidase alpha subunit

SCOPe Domain Sequences for d1hr8a2:

Sequence, based on SEQRES records: (download)

>d1hr8a2 d.185.1.1 (A:234-470) Mitochondrial processing peptidase (MPP) alpha chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vaqytggescippapvfgnlpelfhiqigfeglpidhpdiyalatlqtllggggsfsagg
pgkgmysrlythvlnqyyfvencvafnhsysdsgifgislscipqaapqaveviaqqmyn
tfankdlrltedevsraknqlkssllmnlesklveledmgrqvlmhgrkipvnemiskie
dlkpddisrvaemiftgnvnnagngkgratvvmqgdrgsfgdvenvlkayglgnsss

Sequence, based on observed residues (ATOM records): (download)

>d1hr8a2 d.185.1.1 (A:234-470) Mitochondrial processing peptidase (MPP) alpha chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vaqytggescippapvfgnlpelfhiqigfeglpidhpdiyalatlqtllgggggpgkgm
ysrlythvlnqyyfvencvafnhsysdsgifgislscipqaapqaveviaqqmyntfank
dlrltedevsraknqlkssllmnlesklveledmgrqvlmhgrkipvnemiskiedlkpd
disrvaemiftgnvnnagngkgratvvmqgdrgsfgdvenvlkayglgnsss

SCOPe Domain Coordinates for d1hr8a2:

Click to download the PDB-style file with coordinates for d1hr8a2.
(The format of our PDB-style files is described here.)

Timeline for d1hr8a2: