SCOPe 2.04: Domain d1hr7d2: 1hr7 D:246-462

Lineage for d1hr7d2 (1hr7 D:246-462)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (7 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Mitochondrial processing peptidase (MPP) beta chain [64300] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64301] (4 PDB entries)

8. Domain d1hr7d2: 1hr7 D:246-462 [61187]
   Other proteins in same PDB: d1hr7a1, d1hr7a2, d1hr7c1, d1hr7c2, d1hr7e1, d1hr7e2, d1hr7g1, d1hr7g2
   complexed with zn; mutant

Details for d1hr7d2

PDB Entry: 1hr7, 2.55 Å

PDB Description: yeast mitochondrial processing peptidase beta-e73q mutant

PDB Compounds: (D:) mitochondrial processing peptidase beta subunit

SCOPe Domain Sequences for d1hr7d2:

Sequence; same for both SEQRES and ATOM records:

>d1hr7d2 d.185.1.1 (D:246-462) Mitochondrial processing peptidase (MPP) beta chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gplpvfcrgerfikentlptthiaialegvswsapdyfvalatqaivgnwdraigtgtns
psplavaasqngslansymsfstsyadsglwgmyivtdsnehnvrlivneilkewkriks
gkisdaevnrakaqlkaalllsldgstaivedigrqvvttgkrlspeevfeqvdkitkdd
iimwanyrlqnkpvsmvalgntstvpnvsyieeklnq

Timeline for d1hr7d2:

• d1hr7d2 first appeared in SCOP 1.57
  
• d1hr7d2 appears in SCOPe 2.03
  
• d1hr7d2 appears in SCOPe 2.05
  
• d1hr7d2 appears in the current release, SCOPe 2.08