![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
![]() | Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
![]() | Family d.185.1.1: MPP-like [63412] (6 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
![]() | Protein Mitochondrial processing peptidase (MPP) beta chain [64300] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64301] (4 PDB entries) |
![]() | Domain d1hr7b1: 1hr7 B:24-245 [61182] Other proteins in same PDB: d1hr7a1, d1hr7a2, d1hr7c1, d1hr7c2, d1hr7e1, d1hr7e2, d1hr7g1, d1hr7g2 |
PDB Entry: 1hr7 (more details), 2.55 Å
SCOP Domain Sequences for d1hr7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hr7b1 d.185.1.1 (B:24-245) Mitochondrial processing peptidase (MPP) beta chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} pgtrtsklpngltiateyipntssatvgifvdagsraenvknngtahflqhlafkgtqnr pqqgieleienigshlnaytsrentvyyakslqedipkavdilsdiltksvldnsaiere rdviireseevdkmydevvfdhlheitykdqplgrtilgpikniksitrtdlkdyitkny kgdrmvlagagavdheklvqyaqkyfghvpksespvplgspr
Timeline for d1hr7b1: