Lineage for d1hqva_ (1hqv A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2324637Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)
  6. 2324638Protein Apoptosis-linked protein alg-2 [63551] (1 species)
  7. 2324639Species Mouse (Mus musculus) [TaxId:10090] [63552] (1 PDB entry)
  8. 2324640Domain d1hqva_: 1hqv A: [61160]
    complexed with ca

Details for d1hqva_

PDB Entry: 1hqv (more details), 2.3 Å

PDB Description: structure of apoptosis-linked protein alg-2
PDB Compounds: (A:) programmed cell death protein 6

SCOPe Domain Sequences for d1hqva_:

Sequence, based on SEQRES records: (download)

>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]}
pgpgggpgpaagaalpdqsflwnvfqrvdkdrsgvisdnelqqalsngtwtpfnpvtvrs
iismfdrenkagvnfseftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrls
dqfhdilirkfdrqgrgqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmv
f

Sequence, based on observed residues (ATOM records): (download)

>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]}
pgpgggpgpaalpdqsflwnvfqrvdkdrsgvisdnelqqalsngtwtpfnpvtvrsiis
mfdrenkagvnfseftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqf
hdilirkfdrqgrgqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvf

SCOPe Domain Coordinates for d1hqva_:

Click to download the PDB-style file with coordinates for d1hqva_.
(The format of our PDB-style files is described here.)

Timeline for d1hqva_: