Lineage for d1hqub1 (1hqu B:)

  1. Root: SCOP 1.57
  2. 86313Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)
  3. 86813Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
  4. 86814Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
  5. 86871Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 86872Protein HIV-1 reverse transcriptase [56689] (1 species)
  7. 86873Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (49 PDB entries)
  8. 86940Domain d1hqub1: 1hqu B: [61159]
    Other proteins in same PDB: d1hqua1

Details for d1hqub1

PDB Entry: 1hqu (more details), 2.7 Å

PDB Description: human immunodeficiency virus type 1
PDB Compounds: (B:)

SCOP Domain Sequences for d1hqub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqub1 e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkknksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyqle

SCOP Domain Coordinates for d1hqub1:

Click to download the PDB-style file with coordinates for d1hqub1.
(The format of our PDB-style files is described here.)

Timeline for d1hqub1: