Lineage for d1hqua1 (1hqu A:430-556)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 586264Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 586646Superfamily c.55.3: Ribonuclease H-like [53098] (10 families) (S)
    consists of one domain of this fold
  5. 586647Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 586660Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)
  7. 586661Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (85 PDB entries)
  8. 586720Domain d1hqua1: 1hqu A:430-556 [61157]
    Other proteins in same PDB: d1hqua2, d1hqub_
    complexed with hby; mutant

Details for d1hqua1

PDB Entry: 1hqu (more details), 2.7 Å

PDB Description: human immunodeficiency virus type 1
PDB Compounds: (A:)

SCOP Domain Sequences for d1hqua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqua1 c.55.3.1 (A:430-556) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagi

SCOP Domain Coordinates for d1hqua1:

Click to download the PDB-style file with coordinates for d1hqua1.
(The format of our PDB-style files is described here.)

Timeline for d1hqua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hqua2
View in 3D
Domains from other chains:
(mouse over for more information)
d1hqub_