Lineage for d1hqta_ (1hqt A:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) 
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) 
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (6 proteins) 
Protein Aldose reductase (aldehyde reductase) [51436] (2 species) 
Species Pig (Sus scrofa) [TaxId:9823] [51438] (8 PDB entries) 
Domain d1hqta_: 1hqt A: [61156]
Details for d1hqta_
PDB Entry: 1hqt (more details), 2.2 Å
PDB Description: the crystal structure of an aldehyde reductase y50f mutant-nadp complex and its implications for substrate binding
SCOP Domain Sequences for d1hqta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa)}
aascvllhtgqkmpliglgtwksepgqvkaaikyaltvgyrhidcaaifgneleigealq
etvgpgkavpreelfvtsklwntkhhpedvepalrktladlqleyldlylmhwpyaferg
dnpfpknadgtirydathykdtwkalealvakglvralglsnfssrqiddvlsvasvrpa
vlqvechpylaqneliahcqarglevtaysplgssdrawrdpnepvlleepvvqalaeky
nrspaqillrwqvqrkvicipksvtpsripqniqvfdftfspeemkqldalnknlrfivp
mltvdgkrvprdaghplypfndpy
SCOP Domain Coordinates for d1hqta_:
Click to download the PDB-style file with coordinates for d1hqta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hqta_:
- d1hqta_ is new in SCOP 1.57
- d1hqta_ appears in SCOP 1.59
- d1hqta_ appears in the current release, SCOPe 2.08
View in 3D