Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) the constituent families form similar dimers |
Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins) the active site is between the two identical subunits |
Protein Isocitrate dehydrogenase, ICDH [53668] (2 species) |
Species Bacillus subtilis [TaxId:1423] [64171] (1 PDB entry) |
Domain d1hqsb_: 1hqs B: [61155] complexed with cit, pgo, pgr has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1hqs (more details), 1.55 Å
SCOPe Domain Sequences for d1hqsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hqsb_ c.77.1.1 (B:) Isocitrate dehydrogenase, ICDH {Bacillus subtilis [TaxId: 1423]} maqgekitvsngvlnvpnnpiipfiegdgtgpdiwnaaskvleaavekaykgekkitwke vyagekaynktgewlpaetldvireyfiaikgplttpvgggirslnvalrqeldlfvclr pvryftgvpspvkrpedtdmvifrentediyagieyakgseevqklisflqnelnvnkir fpetsgigikpvseegtsrlvraaidyaiehgrksvtlvhkgnimkftegafknwgyela ekeygdkvftwaqydriaeeqgkdaankaqseaeaagkiiikdsiadiflqqiltrpnef dvvatmnlngdyisdalaaqvggigiapganinyetghaifeathgtapkyagldkvnps svilsgvlllehlgwneaadlviksmektiaskvvtydfarlmdgatevkcsefgeelik nmd
Timeline for d1hqsb_: