Lineage for d1hqsa_ (1hqs A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 493010Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 493011Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (5 families) (S)
    the constituent families form similar dimers
  5. 493012Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (3 proteins)
    the active site is between the two identical subunits
  6. 493054Protein Isocitrate dehydrogenase, ICDH [53668] (2 species)
  7. 493055Species Bacillus subtilis [TaxId:1423] [64171] (1 PDB entry)
  8. 493056Domain d1hqsa_: 1hqs A: [61154]

Details for d1hqsa_

PDB Entry: 1hqs (more details), 1.55 Å

PDB Description: crystal structure of isocitrate dehydrogenase from bacillus subtilis

SCOP Domain Sequences for d1hqsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqsa_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Bacillus subtilis}
maqgekitvsngvlnvpnnpiipfiegdgtgpdiwnaaskvleaavekaykgekkitwke
vyagekaynktgewlpaetldvireyfiaikgplttpvgggirslnvalrqeldlfvclr
pvryftgvpspvkrpedtdmvifrentediyagieyakgseevqklisflqnelnvnkir
fpetsgigikpvseegtsrlvraaidyaiehgrksvtlvhkgnimkftegafknwgyela
ekeygdkvftwaqydriaeeqgkdaankaqseaeaagkiiikdsiadiflqqiltrpnef
dvvatmnlngdyisdalaaqvggigiapganinyetghaifeathgtapkyagldkvnps
svilsgvlllehlgwneaadlviksmektiaskvvtydfarlmdgatevkcsefgeelik
nmd

SCOP Domain Coordinates for d1hqsa_:

Click to download the PDB-style file with coordinates for d1hqsa_.
(The format of our PDB-style files is described here.)

Timeline for d1hqsa_: