SCOP 1.73: Domain d1hqhb_: 1hqh B:

Lineage for d1hqhb_ (1hqh B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456

4. Superfamily c.42.1: Arginase/deacetylase [52768] (2 families)

5. Family c.42.1.1: Arginase-like amidino hydrolases [52769] (4 proteins)
   Pfam PF00491

6. Protein Arginase [52770] (5 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [52771] (31 PDB entries)

8. Domain d1hqhb_: 1hqh B: [61140]

Details for d1hqhb_

PDB Entry: 1hqh, 2.8 Å

PDB Description: crystal structure of the binuclear manganese metalloenzyme arginase complexed with nor-n-hydroxy-l-arginine

PDB Compounds: (B:) arginase 1

SCOP Domain Sequences for d1hqhb_:

Sequence; same for both SEQRES and ATOM records:

>d1hqhb_ c.42.1.1 (B:) Arginase {Rat (Rattus norvegicus) [TaxId: 10116]}
kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcviwvda
htdintplttssgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg
ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg
tkregnhkpetdyl

Timeline for d1hqhb_:

• d1hqhb_ first appeared in SCOP 1.57
  
• d1hqhb_ appears in SCOP 1.71
  
• d1hqhb_ appears in SCOP 1.75
  
• d1hqhb_ appears in the current release, SCOPe 2.08