![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.42: Arginase/deacetylase [52767] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456 |
![]() | Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) ![]() |
![]() | Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins) Pfam PF00491 |
![]() | Protein Arginase [52770] (5 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [52771] (34 PDB entries) Uniprot P07824 |
![]() | Domain d1hqfb_: 1hqf B: [61134] complexed with har, mn |
PDB Entry: 1hqf (more details), 2.9 Å
SCOPe Domain Sequences for d1hqfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hqfb_ c.42.1.1 (B:) Arginase {Norway rat (Rattus norvegicus) [TaxId: 10116]} kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcviwvda htdintplttssgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg tkregnhkpetdyl
Timeline for d1hqfb_: