Lineage for d1hqda_ (1hqd A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1870196Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
    lack the first two strands of the common fold
  6. 1870197Protein Lipase [53571] (4 species)
  7. 1870198Species Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId:292] [63399] (6 PDB entries)
  8. 1870203Domain d1hqda_: 1hqd A: [61129]
    complexed with ca, ink

Details for d1hqda_

PDB Entry: 1hqd (more details), 2.3 Å

PDB Description: pseudomonas cepacia lipase complexed with transition state analogue of 1-phenoxy-2-acetoxy butane
PDB Compounds: (A:) Lipase

SCOPe Domain Sequences for d1hqda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqda_ c.69.1.18 (A:) Lipase {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]}
adnyaatrypiilvhgltgtdkyagvleywygiqedlqqrgatvyvanlsgfqsddgpng
rgeqllayvktvlaatgatkvnlvghsqggltsryvaavapdlvasvttigtphrgsefa
dfvqgvlaydptglsstviaafvnvfgiltsssnntnqdalaalktlttaqaatynqnyp
saglgapgscqtgaptetvggnthllyswagtaiqptisvfgvtgatdtstiplvdpana
ldpstlalfgtgtvmvnrgsgqndgvvskcsalygqvlstsykwnhldeinqllgvrgan
aedpvavirthanrlklagv

SCOPe Domain Coordinates for d1hqda_:

Click to download the PDB-style file with coordinates for d1hqda_.
(The format of our PDB-style files is described here.)

Timeline for d1hqda_: