| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
| Family a.28.1.3: apo-D-alanyl carrier protein [63535] (1 protein) automatically mapped to Pfam PF00550 |
| Protein apo-D-alanyl carrier protein [63536] (1 species) |
| Species Lactobacillus casei [TaxId:1582] [63537] (2 PDB entries) |
| Domain d1hqba_: 1hqb A: [61128] |
PDB Entry: 1hqb (more details)
SCOPe Domain Sequences for d1hqba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hqba_ a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacillus casei [TaxId: 1582]}
adeaikngvldiladltgsddvkknldlnlfetglldsmgtvqlllelqsqfgvdapvse
fdrkewdtpnkiiakveqaq
Timeline for d1hqba_: