SCOPe 2.07: Domain d1hq8a_: 1hq8 A:

Lineage for d1hq8a_ (1hq8 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein NK cell-activating receptor nkg2d [64453] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [64454] (2 PDB entries)

8. Domain d1hq8a_: 1hq8 A: [61127]

Details for d1hq8a_

PDB Entry: 1hq8, 1.95 Å

PDB Description: crystal structure of the murine nk cell-activating receptor nkg2d at 1.95 a

PDB Compounds: (A:) nkg2-d

SCOPe Domain Sequences for d1hq8a_:

Sequence; same for both SEQRES and ATOM records:

>d1hq8a_ d.169.1.1 (A:) NK cell-activating receptor nkg2d {Mouse (Mus musculus) [TaxId: 10090]}
gycgpcpnnwichrnncyqffneektwnqsqasclsqnssllkiyskeeqdflklvksyh
wmglvqipangswqwedgsslsynqltlveipkgscavygssfkaytedcanlntyicmk
rav

Timeline for d1hq8a_:

• d1hq8a_ first appeared in SCOP 1.57
  
• d1hq8a_ appears in SCOPe 2.06
  
• d1hq8a_ appears in the current release, SCOPe 2.08