Lineage for d1hq5b_ (1hq5 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129859Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2129860Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2129861Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. 2129882Protein Arginase [52770] (5 species)
  7. 2129989Species Norway rat (Rattus norvegicus) [TaxId:10116] [52771] (34 PDB entries)
    Uniprot P07824
  8. 2129999Domain d1hq5b_: 1hq5 B: [61124]
    complexed with mn, s2c

Details for d1hq5b_

PDB Entry: 1hq5 (more details), 2.3 Å

PDB Description: crystal structure of the binuclear manganese metalloenzyme arginase complexed with s-(2-boronoethyl)-l-cysteine, an l-arginine analogue
PDB Compounds: (B:) arginase 1

SCOPe Domain Sequences for d1hq5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hq5b_ c.42.1.1 (B:) Arginase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcviwvda
htdintplttssgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg
ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg
tkregnhk

SCOPe Domain Coordinates for d1hq5b_:

Click to download the PDB-style file with coordinates for d1hq5b_.
(The format of our PDB-style files is described here.)

Timeline for d1hq5b_: