![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds) |
![]() | Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
![]() | Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) ![]() "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
![]() | Family e.8.1.2: Reverse transcriptase [56686] (2 proteins) |
![]() | Protein HIV-1 reverse transcriptase [56689] (2 species) |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (83 PDB entries) |
![]() | Domain d1hpzb_: 1hpz B: [61121] Other proteins in same PDB: d1hpza1 complexed with aap; mutant |
PDB Entry: 1hpz (more details), 3 Å
SCOP Domain Sequences for d1hpzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hpzb_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1} pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkknksvtvldvgdayfsvpl dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp plvklwyqle
Timeline for d1hpzb_: