Lineage for d1hpza1 (1hpz A:430-556)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701966Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) (S)
    consists of one domain of this fold
  5. 701967Family c.55.3.1: Ribonuclease H [53099] (4 proteins)
  6. 701998Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)
  7. 701999Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (85 PDB entries)
  8. 702068Domain d1hpza1: 1hpz A:430-556 [61119]
    Other proteins in same PDB: d1hpza2, d1hpzb_
    complexed with aap; mutant

Details for d1hpza1

PDB Entry: 1hpz (more details), 3 Å

PDB Description: human immunodeficiency virus type 1
PDB Compounds: (A:) Pol polyprotein

SCOP Domain Sequences for d1hpza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hpza1 c.55.3.1 (A:430-556) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagi

SCOP Domain Coordinates for d1hpza1:

Click to download the PDB-style file with coordinates for d1hpza1.
(The format of our PDB-style files is described here.)

Timeline for d1hpza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hpza2
View in 3D
Domains from other chains:
(mouse over for more information)
d1hpzb_