SCOP 1.73: Domain d1hpwa_: 1hpw A:

Lineage for d1hpwa_ (1hpw A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.24: Pili subunits [54522] (1 superfamily)
   contains very long N-terminal helix, which end is packed against beta-sheet

4. Superfamily d.24.1: Pili subunits [54523] (4 families)
   bacterial filament proteins

5. Family d.24.1.1: Pilin [54524] (4 proteins)

6. Protein Pilin P1 [109619] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [64247] (3 PDB entries)

8. Domain d1hpwa_: 1hpw A: [61118]

Details for d1hpwa_

PDB Entry: 1hpw

PDB Description: structure of a pilin monomer from pseudomonas aeruginosa: implications for the assembly of pili.

PDB Compounds: (A:) fimbrial protein

SCOP Domain Sequences for d1hpwa_:

Sequence; same for both SEQRES and ATOM records:

>d1hpwa_ d.24.1.1 (A:) Pilin P1 {Pseudomonas aeruginosa [TaxId: 287]}
alegtefaraqlseamtlasglktkvsdifsqdgscpantaatagiekdtdingkyvakv
ttggtaaasggctivatmkasdvatplrgktltltlgnadkgsytwactsnadnkylpkt
cqtattttp

Timeline for d1hpwa_:

• d1hpwa_ first appeared in SCOP 1.57
  
• d1hpwa_ appears in SCOP 1.71
  
• d1hpwa_ appears in SCOP 1.75
  
• d1hpwa_ appears in the current release, SCOPe 2.08, called d1hpwa1