| Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
| Fold d.24: Pili subunits [54522] (1 superfamily) contains very long N-terminal helix, which end is packed against beta-sheet |
Superfamily d.24.1: Pili subunits [54523] (3 families) ![]() bacterial filament proteins |
| Family d.24.1.1: Pilin [54524] (4 proteins) |
| Protein Pilin P1 [109619] (1 species) |
| Species Pseudomonas aeruginosa [TaxId:287] [64247] (3 PDB entries) |
| Domain d1hpwa_: 1hpw A: [61118] |
PDB Entry: 1hpw (more details)
SCOP Domain Sequences for d1hpwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hpwa_ d.24.1.1 (A:) Pilin P1 {Pseudomonas aeruginosa}
alegtefaraqlseamtlasglktkvsdifsqdgscpantaatagiekdtdingkyvakv
ttggtaaasggctivatmkasdvatplrgktltltlgnadkgsytwactsnadnkylpkt
cqtattttp
Timeline for d1hpwa_: