Lineage for d1hp5a2 (1hp5 A:8-150)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2571709Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2571710Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins)
    family GH20
  6. 2571749Protein beta-N-acetylhexosaminidase, N-terminal domain [64343] (1 species)
  7. 2571750Species Streptomyces plicatus [TaxId:1922] [64344] (8 PDB entries)
  8. 2571754Domain d1hp5a2: 1hp5 A:8-150 [61114]
    Other proteins in same PDB: d1hp5a1
    complexed with cl, gol, ngt, so4

Details for d1hp5a2

PDB Entry: 1hp5 (more details), 2.1 Å

PDB Description: streptomyces plicatus beta-n-acetylhexosaminidase complexed with intermediate analouge nag-thiazoline
PDB Compounds: (A:) beta-n-acetylhexosaminidase

SCOPe Domain Sequences for d1hp5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hp5a2 d.92.2.1 (A:8-150) beta-N-acetylhexosaminidase, N-terminal domain {Streptomyces plicatus [TaxId: 1922]}
drkapvrptpldrvipapasvdpggapyritrgthirvddsrearrvgdyladllrpatg
yrlpvtahghggirlrlaggpygdegyrldsgpagvtitarkaaglfhgvqtlrqllppa
vekdsaqpgpwlvaggtiedtpr

SCOPe Domain Coordinates for d1hp5a2:

Click to download the PDB-style file with coordinates for d1hp5a2.
(The format of our PDB-style files is described here.)

Timeline for d1hp5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hp5a1