Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) contains similar fold but lacks its catalytic centre |
Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins) family GH20 |
Protein beta-N-acetylhexosaminidase, N-terminal domain [64343] (1 species) |
Species Streptomyces plicatus [TaxId:1922] [64344] (8 PDB entries) |
Domain d1hp5a2: 1hp5 A:8-150 [61114] Other proteins in same PDB: d1hp5a1 complexed with cl, gol, ngt, so4 |
PDB Entry: 1hp5 (more details), 2.1 Å
SCOPe Domain Sequences for d1hp5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hp5a2 d.92.2.1 (A:8-150) beta-N-acetylhexosaminidase, N-terminal domain {Streptomyces plicatus [TaxId: 1922]} drkapvrptpldrvipapasvdpggapyritrgthirvddsrearrvgdyladllrpatg yrlpvtahghggirlrlaggpygdegyrldsgpagvtitarkaaglfhgvqtlrqllppa vekdsaqpgpwlvaggtiedtpr
Timeline for d1hp5a2: