![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (2 families) ![]() contains similar fold but lacks its catalytic centre |
![]() | Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (3 proteins) family GH20 |
![]() | Protein beta-N-acetylhexosaminidase, N-terminal domain [64343] (1 species) |
![]() | Species Streptomyces plicatus [TaxId:1922] [64344] (6 PDB entries) |
![]() | Domain d1hp5a2: 1hp5 A:8-150 [61114] Other proteins in same PDB: d1hp5a1 complexed with cl, gol, ngt, so4 |
PDB Entry: 1hp5 (more details), 2.1 Å
SCOP Domain Sequences for d1hp5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hp5a2 d.92.2.1 (A:8-150) beta-N-acetylhexosaminidase, N-terminal domain {Streptomyces plicatus} drkapvrptpldrvipapasvdpggapyritrgthirvddsrearrvgdyladllrpatg yrlpvtahghggirlrlaggpygdegyrldsgpagvtitarkaaglfhgvqtlrqllppa vekdsaqpgpwlvaggtiedtpr
Timeline for d1hp5a2: