Lineage for d1hp5a2 (1hp5 A:8-150)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) 
Superfamily d.92.2: beta-N-acetylhexosaminidase domain [55545] (1 family) 
Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (2 proteins) 
Protein beta-N-acetylhexosaminidase, N-terminal domain [64343] (1 species) Species Streptomyces plicatus [TaxId:1922] [64344] (2 PDB entries) 
Domain d1hp5a2: 1hp5 A:8-150 [61114]
Other proteins in same PDB: d1hp5a1
Details for d1hp5a2
PDB Entry: 1hp5 (more details), 2.1 Å
PDB Description: streptomyces plicatus beta-n-acetylhexosaminidase complexed with intermediate analouge nag-thiazoline
SCOP Domain Sequences for d1hp5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hp5a2 d.92.2.1 (A:8-150) beta-N-acetylhexosaminidase, N-terminal domain {Streptomyces plicatus}
drkapvrptpldrvipapasvdpggapyritrgthirvddsrearrvgdyladllrpatg
yrlpvtahghggirlrlaggpygdegyrldsgpagvtitarkaaglfhgvqtlrqllppa
vekdsaqpgpwlvaggtiedtpr
SCOP Domain Coordinates for d1hp5a2:
Click to download the PDB-style file with coordinates for d1hp5a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hp5a2:
- d1hp5a2 is new in SCOP 1.57
- d1hp5a2 appears in SCOP 1.59
- d1hp5a2 appears in the current release, SCOPe 2.08
View in 3D
