Lineage for d1hp5a1 (1hp5 A:151-506)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305661Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 306464Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (3 proteins)
    Glycosyl hydrolase family 20, GH20
  6. 306479Protein beta-N-acetylhexosaminidase [63915] (1 species)
  7. 306480Species Streptomyces plicatus [TaxId:1922] [63916] (6 PDB entries)
  8. 306484Domain d1hp5a1: 1hp5 A:151-506 [61113]
    Other proteins in same PDB: d1hp5a2
    complexed with cl, gol, ngt, so4

Details for d1hp5a1

PDB Entry: 1hp5 (more details), 2.1 Å

PDB Description: streptomyces plicatus beta-n-acetylhexosaminidase complexed with intermediate analouge nag-thiazoline

SCOP Domain Sequences for d1hp5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hp5a1 c.1.8.6 (A:151-506) beta-N-acetylhexosaminidase {Streptomyces plicatus}
yawrsamldvsrhffgvdevkryidrvarykynklhlhlsddqgwriaidswprlatygg
stevgggpggyytkaeykeivryaasrhlevvpeidmpghtnaalasyaelncdgvappl
ytgtkvgfsslcvdkdvtydfvddvigelaaltpgrylhiggdeahstpkadfvafmkrv
qpivakygktvvgwhqlagaepvegalvqywgldrtgdaekaevaeaarngtglilspad
rtyldmkytkdtplglswagyvevqrsydwdpagylpgapadavrgveaplwtetlsdpd
qldymafprlpgvaelgwspasthdwdtykvrlaaqapyweaagidfyrspqvpwt

SCOP Domain Coordinates for d1hp5a1:

Click to download the PDB-style file with coordinates for d1hp5a1.
(The format of our PDB-style files is described here.)

Timeline for d1hp5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hp5a2