Lineage for d1hp5a1 (1hp5 A:151-506)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) 
Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (2 proteins) 
Protein beta-N-acetylhexosaminidase [63915] (1 species) Species Streptomyces plicatus [TaxId:1922] [63916] (2 PDB entries) 
Domain d1hp5a1: 1hp5 A:151-506 [61113]
Other proteins in same PDB: d1hp5a2
Details for d1hp5a1
PDB Entry: 1hp5 (more details), 2.1 Å
PDB Description: streptomyces plicatus beta-n-acetylhexosaminidase complexed with intermediate analouge nag-thiazoline
SCOP Domain Sequences for d1hp5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hp5a1 c.1.8.6 (A:151-506) beta-N-acetylhexosaminidase {Streptomyces plicatus}
yawrsamldvsrhffgvdevkryidrvarykynklhlhlsddqgwriaidswprlatygg
stevgggpggyytkaeykeivryaasrhlevvpeidmpghtnaalasyaelncdgvappl
ytgtkvgfsslcvdkdvtydfvddvigelaaltpgrylhiggdeahstpkadfvafmkrv
qpivakygktvvgwhqlagaepvegalvqywgldrtgdaekaevaeaarngtglilspad
rtyldmkytkdtplglswagyvevqrsydwdpagylpgapadavrgveaplwtetlsdpd
qldymafprlpgvaelgwspasthdwdtykvrlaaqapyweaagidfyrspqvpwt
SCOP Domain Coordinates for d1hp5a1:
Click to download the PDB-style file with coordinates for d1hp5a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hp5a1:
- d1hp5a1 is new in SCOP 1.57
- d1hp5a1 appears in SCOP 1.59
- d1hp5a1 appears in the current release, SCOPe 2.08
View in 3D
