Lineage for d1ho8a_ (1ho8 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006692Family a.118.1.9: Regulatory subunit H of the V-type ATPase [63614] (1 protein)
  6. 2006693Protein Regulatory subunit H of the V-type ATPase [63615] (1 species)
  7. 2006694Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63616] (2 PDB entries)
  8. 2006695Domain d1ho8a_: 1ho8 A: [61107]
    complexed with so4

Details for d1ho8a_

PDB Entry: 1ho8 (more details), 2.95 Å

PDB Description: crystal structure of the regulatory subunit h of the v-type atpase of saccharomyces cerevisiae
PDB Compounds: (A:) vacuolar ATP synthase subunit h

SCOPe Domain Sequences for d1ho8a_:

Sequence, based on SEQRES records: (download)

>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gatkilmdsthfneirsiirsrsvawdalarseelseidastakalesilvkknigdgls
ssnnahsgfkvngktliplihllstsdnedckksvqnliaellssdkygddtvkffqedp
kqleqlfdvslkgdfqtvlisgfnvvsllvqnglhnvklvekllknnnlinilqnieqmd
tcyvcirllqelavipeyrdviwlhekkfmptlfkilqratdsqlatrivatnsnhlgiq
lqyhsllliwlltfnpvfanelvqkylsdfldllklvkitikekvsrlcisiilqccstr
vkqhkkvikqllllgnalptvqslserkysdeelrqdisnlkeileneyqeltsfdeyva
eldskllcwspphvdngfwsdnidefkkdnykifrqliellqakvrngdvnakqekiiiq
valndithvvellpesidvldktggkadimellnhsdsrvkyealkatqaiigytfk

Sequence, based on observed residues (ATOM records): (download)

>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gatkilmdsthfneirsiirsrsvawdalarseelseidastakalesilvkkvngktli
plihllstsdnedckksvqnliaellssdkygddtvkffqedpkqleqlfdvslkgdfqt
vlisgfnvvsllvqnglhnvklvekllknnnlinilqnieqmdtcyvcirllqelavipe
yrdviwlhekkfmptlfkilqratdhlgiqlqyhsllliwlltfnpvfanelvqkylsdf
ldllklvkitikekvsrlcisiilqccstrvkqhkkvikqllllgnalptvqslserkys
deelrqdisnlkeileneyqeltsfdeyvaeldskllcwspphvdngfwsdnidefkkdn
ykifrqliellqakvrngdvnakqekiiiqvalndithvvellpesidvldktggkadim
ellnhsdsrvkyealkatqaiigytfk

SCOPe Domain Coordinates for d1ho8a_:

Click to download the PDB-style file with coordinates for d1ho8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ho8a_: