SCOPe 2.06: Domain d1ho4b_: 1ho4 B:

Lineage for d1ho4b_ (1ho4 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.24: Pyridoxine 5'-phosphate synthase [63892] (2 families)

5. Family c.1.24.1: Pyridoxine 5'-phosphate synthase [63893] (2 proteins)
   automatically mapped to Pfam PF03740

6. Protein Pyridoxine 5'-phosphate synthase [63894] (1 species)

7. Species Escherichia coli [TaxId:562] [63895] (7 PDB entries)

8. Domain d1ho4b_: 1ho4 B: [61104]
   complexed with po4, pxp

Details for d1ho4b_

PDB Entry: 1ho4, 2.3 Å

PDB Description: crystal structure of pyridoxine 5'-phosphate synthase in complex with pyridoxine 5'-phosphate and inorganic phosphate

PDB Compounds: (B:) pyridoxine 5'-phosphate synthase

SCOPe Domain Sequences for d1ho4b_:

Sequence; same for both SEQRES and ATOM records:

>d1ho4b_ c.1.24.1 (B:) Pyridoxine 5'-phosphate synthase {Escherichia coli [TaxId: 562]}
aelllgvnidhiatlrnargtaypdpvqaafiaeqagadgitvhlredrrhitdrdvril
rqtldtrmnlemavteemlaiavetkphfcclvpekrqevtteggldvagqrdkmrdack
rladagiqvslfidadeeqikaaaevgapfieihtgcyadaktdaeqaqelariakaatf
aaslglkvnaghgltyhnvkaiaaipemhelnighaiigravmtglkdavaemkrlmlea
rg

Timeline for d1ho4b_:

• d1ho4b_ first appeared in SCOP 1.57
  
• d1ho4b_ appears in SCOPe 2.05
  
• d1ho4b_ appears in SCOPe 2.07
  
• d1ho4b_ appears in the current release, SCOPe 2.08