Lineage for d1hnua_ (1hnu A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 240584Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 240585Superfamily c.14.1: ClpP/crotonase [52096] (3 families) (S)
  5. 240639Family c.14.1.3: Crotonase-like [52103] (6 proteins)
  6. 240664Protein Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) [52108] (2 species)
  7. 240665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63954] (2 PDB entries)
  8. 240666Domain d1hnua_: 1hnu A: [61096]
    complexed with edo, reo

Details for d1hnua_

PDB Entry: 1hnu (more details), 2.15 Å

PDB Description: crystal structure of peroxisomal delta3-delta2-enoyl-coa isomerase from saccharomyces cerevisiae

SCOP Domain Sequences for d1hnua_:

Sequence, based on SEQRES records: (download)

>d1hnua_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae)}
nekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssgrffs
sgadfkgiakaqgddtnkypsetskwvsnfvarnvyvtdafikhskvlicclngpaigls
aalvalcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkpfkyd
imcengfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhidafnka
nsvevneslkywvdgeplkrfrq

Sequence, based on observed residues (ATOM records): (download)

>d1hnua_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae)}
nekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssgrffs
sgadfketskwvsnfvarnvyvtdafikhskvlicclngpaiglsaalvalcdivysind
kvyllypfanlgliteggttvslplkfgtnttyeclmfnkpfkydimcengfisknfnmp
ssnaeafnakvleelrekvkglylpsclgmkkllksnhidafnkansvevneslkywvdg
eplkrfrq

SCOP Domain Coordinates for d1hnua_:

Click to download the PDB-style file with coordinates for d1hnua_.
(The format of our PDB-style files is described here.)

Timeline for d1hnua_: