Lineage for d1hnoa_ (1hno A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099550Family c.14.1.3: Crotonase-like [52103] (14 protein domains)
  6. 2099623Protein Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) [52108] (5 species)
  7. 2099624Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63954] (4 PDB entries)
  8. 2099629Domain d1hnoa_: 1hno A: [61095]
    complexed with edo

Details for d1hnoa_

PDB Entry: 1hno (more details), 2.5 Å

PDB Description: crystal structure of peroxisomal delta3-delta2-enoyl-coa isomerase from saccharomyces cerevisiae
PDB Compounds: (A:) d3,d2-enoyl coa isomerase eci1

SCOPe Domain Sequences for d1hnoa_:

Sequence, based on SEQRES records: (download)

>d1hnoa_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssgrffs
sgadfkgiakaqgddtnkypsetskwvsnfvarnvyvtdafikhskvlicclngpaigls
aalvalcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkpfkyd
imcengfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhidafnka
nsvevneslkywvdgeplkrfrq

Sequence, based on observed residues (ATOM records): (download)

>d1hnoa_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssgrffs
sgadfketskwvsnfvarnvyvtdafikhskvlicclngpaiglsaalvalcdivysind
kvyllypfanlgliteggttvslplkfgtnttyeclmfnkpfkydimcengfisknfnmp
ssnaeafnakvleelrekvkglylpsclgmkkllksnhidafnkansvevneslkywvdg
eplkrfrq

SCOPe Domain Coordinates for d1hnoa_:

Click to download the PDB-style file with coordinates for d1hnoa_.
(The format of our PDB-style files is described here.)

Timeline for d1hnoa_: